|
|
|
|
|
|
|
| Information on 1dpe_*_62 |
|
Loop code: 1dpe_*_62 PDB: 1dpe Chain: * Type: EH beta-alpha |
Loop Start: 62 Loop Length: 19 Sec Struct Nt length: 6 Sec Struct Ct length: 12 Structure geometry
|
| Sequence: | TYTFHLRKGVKWHDNKEFKPTRELNADDVVFSFDRQK |
| Sec Struct: | EEEEEE-SS------SS---SS---HHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| CDCADMIUM ION | T - 64 | 1 | 0 |
| CDCADMIUM ION | H - 66 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|