|
|
|
|
|
|
|
| Information on 1dpe_*_303 |
|
Loop code: 1dpe_*_303 PDB: 1dpe Chain: * Type: EH beta-alpha |
Loop Start: 303 Loop Length: 22 Sec Struct Nt length: 3 Sec Struct Ct length: 10 Structure geometry
|
| Sequence: | GVSAKNLIPPTMWGYNDDVQDYTYDPEKAKALLKE |
| Sec Struct: | EEE-SSSS-TTSTT--TT-------HHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| CDCADMIUM ION | W - 315 | 0 | 1 |
| CDCADMIUM ION | Q - 322 | 0 | 1 |
| CDCADMIUM ION | D - 323 | 0 | 1 |
| CDCADMIUM ION | Y - 324 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|