|
|
|
|
|
|
|
| Information on 1m15_A_120 |
|
Loop code: 1m15_A_120 PDB: 1m15 Chain: A Type: EH beta-alpha |
Loop Start: 120 Loop Length: 12 Sec Struct Nt length: 10 Sec Struct Ct length: 15 Structure geometry
|
| Sequence: | IISTRVRCGRSLQGYPFNPCLTAEQYKEMEEKVSSTL |
| Sec Struct: | EEEEEEEEEE-BTT---GGG--HHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| ADPADENOSINE-5'-DIPHOSPHATE | S - 122 | 1 | 0 |
| ADPADENOSINE-5'-DIPHOSPHATE | T - 123 | 1 | 0 |
| ADPADENOSINE-5'-DIPHOSPHATE | R - 124 | 1 | 0 |
| ADPADENOSINE-5'-DIPHOSPHATE | R - 126 | 1 | 0 |
| ARGARGININE | R - 126 | 1 | 0 |
| MGMAGNESIUM ION | R - 126 | 1 | 0 |
| Associated ArchDB95 Subclass to 1m15_A_120 |
| Associated ArchDB-EC Subclass to 1m15_A_120 |
| For any comment or web-related incidence, send an email to the webmaster. |
|