|
|
|
|
|
|
|
| Information on 1sqh_A_174 |
|
Loop code: 1sqh_A_174 PDB: 1sqh Chain: A Type: EH beta-alpha |
Loop Start: 174 Loop Length: 20 Sec Struct Nt length: 4 Sec Struct Ct length: 10 Structure geometry
|
| Sequence: | FEIRRLRAEDAAVHDSWPNKGEGSLTYLQALVRF |
| Sec Struct: | EEEE---GGG----TT-TT-SSS-HHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MSESELENOMETHIONINE | E - 182 | 0 | 1 |
| MSESELENOMETHIONINE | D - 183 | 0 | 1 |
| MSESELENOMETHIONINE | A - 184 | 0 | 1 |
| MSESELENOMETHIONINE | A - 185 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|