|
|
|
|
|
|
|
| Information on 1ifq_A_69 |
|
Loop code: 1ifq_A_69 PDB: 1ifq Chain: A Type: EH beta-alpha |
Loop Start: 69 Loop Length: 6 Sec Struct Nt length: 6 Sec Struct Ct length: 19 Structure geometry
|
| Sequence: | VCYLVLCEAAFPKKLAFAYLEDLHSEFDEQH |
| Sec Struct: | EEEEEE--TTS-HHHHHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MSESELENOMETHIONINE | C - 70 | 1 | 0 |
| MSESELENOMETHIONINE | Y - 71 | 1 | 0 |
| MSESELENOMETHIONINE | L - 72 | 1 | 0 |
| MSESELENOMETHIONINE | V - 73 | 0 | 1 |
| MSESELENOMETHIONINE | L - 74 | 0 | 1 |
| MSESELENOMETHIONINE | C - 75 | 0 | 1 |
| MSESELENOMETHIONINE | E - 76 | 0 | 1 |
| MSESELENOMETHIONINE | A - 77 | 0 | 1 |
| GOLGLYCEROL | Q - 98 | 1 | 0 |
| GOLGLYCEROL | H - 99 | 1 | 0 |
| Associated ArchDB40 Subclass to 1ifq_A_69 |
| Associated ArchDB95 Subclass to 1ifq_A_69 |
| For any comment or web-related incidence, send an email to the webmaster. |
|