|
|
|
|
|
|
|
| Information on 1a9x_A_803 |
|
Loop code: 1a9x_A_803 PDB: 1a9x Chain: A Type: HE alpha-beta |
Loop Start: 803 Loop Length: 4 Sec Struct Nt length: 17 Sec Struct Ct length: 9 Structure geometry
|
| Sequence: | QEIQDVMRQQVQKLAFELQVRGLMNVQFAV |
| Sec Struct: | HHHHHHHHHHHHHHHHHTT--EEEEEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| PO4PHOSPHATE ION | Q - 803 | 1 | 0 |
| PO4PHOSPHATE ION | Q - 806 | 1 | 0 |
| MNMANGANESE (II) ION | N - 827 | 1 | 0 |
| ADPADENOSINE-5'-DIPHOSPHATE | Q - 829 | 1 | 0 |
| MNMANGANESE (II) ION | Q - 829 | 1 | 0 |
| ADPADENOSINE-5'-DIPHOSPHATE | A - 831 | 1 | 0 |
| Associated ArchDB40 Subclass to 1a9x_A_803 |
| Associated ArchDB95 Subclass to 1a9x_A_803 |
| For any comment or web-related incidence, send an email to the webmaster. |
|