|
|
|
|
|
|
|
| Information on 1gxm_A_354 |
|
Loop code: 1gxm_A_354 PDB: 1gxm Chain: A Type: HE alpha-beta |
Loop Start: 354 Loop Length: 26 Sec Struct Nt length: 6 Sec Struct Ct length: 2 Structure geometry
|
| Sequence: | ADVVLSYQQNNGGWPKNLDYNSVGNGGGGNESGT |
| Sec Struct: | HHHHHHT--TTS---S---TTT--------S-EE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| GOLGLYCEROL | W - 367 | 0 | 1 |
| GOLGLYCEROL | P - 368 | 0 | 1 |
| GOLGLYCEROL | K - 369 | 0 | 1 |
| GOLGLYCEROL | N - 370 | 0 | 1 |
| GOLGLYCEROL | L - 371 | 0 | 1 |
| GOLGLYCEROL | Y - 373 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|