|
|
|
|
|
|
|
| Information on 1a28_A_744 |
|
Loop code: 1a28_A_744 PDB: 1a28 Chain: A Type: HE alpha-beta |
Loop Start: 744 Loop Length: 4 Sec Struct Nt length: 28 Sec Struct Ct length: 4 Structure geometry
|
| Sequence: | IDDQITLIQYSWMSLMVFGLGWRSYKHVSGQMLYFA |
| Sec Struct: | HHHHHHHHHHHHHHHHHHHHHHHHHHHHTTSSEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| STRPROGESTERONE | W - 755 | 1 | 0 |
| STRPROGESTERONE | M - 756 | 1 | 0 |
| STRPROGESTERONE | M - 759 | 1 | 0 |
| STRPROGESTERONE | V - 760 | 1 | 0 |
| STRPROGESTERONE | G - 762 | 1 | 0 |
| STRPROGESTERONE | L - 763 | 1 | 0 |
| STRPROGESTERONE | R - 766 | 1 | 0 |
| STRPROGESTERONE | Y - 777 | 1 | 0 |
| STRPROGESTERONE | F - 778 | 1 | 0 |
| Associated ArchDB95 Subclass to 1a28_A_744 |
| For any comment or web-related incidence, send an email to the webmaster. |
|