|
|
|
|
|
|
|
| Information on 1jj2_A_5 |
|
Loop code: 1jj2_A_5 PDB: 1jj2 Chain: A Type: HE alpha-beta |
Loop Start: 5 Loop Length: 28 Sec Struct Nt length: 6 Sec Struct Ct length: 10 Structure geometry
|
| Sequence: | QGQRRGRGTSTFRAPSHRYKADLEHRKVEDGDVIAGTVVDIEHD |
| Sec Struct: | HHHHHHT--GGGS--GGG-----------SSS--EEEEEEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MGMAGNESIUM ION | S - 14 | 0 | 1 |
| MGMAGNESIUM ION | T - 15 | 0 | 1 |
| MGMAGNESIUM ION | F - 16 | 0 | 1 |
| MGMAGNESIUM ION | R - 17 | 0 | 1 |
| MGMAGNESIUM ION | P - 19 | 0 | 1 |
| MGMAGNESIUM ION | A - 25 | 0 | 1 |
| MGMAGNESIUM ION | D - 26 | 0 | 1 |
| MGMAGNESIUM ION | L - 27 | 0 | 1 |
| MGMAGNESIUM ION | E - 28 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|