|
|
|
|
|
|
|
| Information on 1uwv_A_97 |
|
Loop code: 1uwv_A_97 PDB: 1uwv Chain: A Type: HE alpha-beta |
Loop Start: 97 Loop Length: 18 Sec Struct Nt length: 14 Sec Struct Ct length: 5 Structure geometry
|
| Sequence: | VDLQQRSKSAALARLKHDVSEVIADVPWGYRRRARLS |
| Sec Struct: | HHHHHHHHHHHHHH------------SSS-BSEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MSESELENOMETHIONINE | Q - 100 | 1 | 0 |
| MSESELENOMETHIONINE | Q - 101 | 1 | 0 |
| MSESELENOMETHIONINE | K - 104 | 1 | 0 |
| MSESELENOMETHIONINE | S - 105 | 1 | 0 |
| MSESELENOMETHIONINE | A - 107 | 1 | 0 |
| MSESELENOMETHIONINE | L - 108 | 1 | 0 |
| MSESELENOMETHIONINE | A - 109 | 0 | 1 |
| MSESELENOMETHIONINE | R - 110 | 0 | 1 |
| MSESELENOMETHIONINE | L - 111 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|