|
|
|
|
|
|
|
| Information on 1qfm_A_605 |
|
Loop code: 1qfm_A_605 PDB: 1qfm Chain: A Type: HE alpha-beta |
Loop Start: 605 Loop Length: 17 Sec Struct Nt length: 10 Sec Struct Ct length: 7 Structure geometry
|
| Sequence: | KQHFEWLIKYSPLHNVKLPEADDIQYPSMLLLTA |
| Sec Struct: | HHHHHHHHHH-GGG-----SSTT----EEEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| CSWCYSTEINE-S-DIOXIDE | K - 605 | 1 | 0 |
| CSWCYSTEINE-S-DIOXIDE | H - 607 | 1 | 0 |
| CSWCYSTEINE-S-DIOXIDE | F - 608 | 1 | 0 |
| CSWCYSTEINE-S-DIOXIDE | W - 610 | 1 | 0 |
| CSWCYSTEINE-S-DIOXIDE | L - 611 | 1 | 0 |
| CSXS-OXY CYSTEINE | H - 618 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|