|
|
|
|
|
|
|
| Information on 1lug_A_218 |
|
Loop code: 1lug_A_218 PDB: 1lug Chain: A Type: HE alpha-beta |
Loop Start: 218 Loop Length: 30 Sec Struct Nt length: 7 Sec Struct Ct length: 2 Structure geometry
|
| Sequence: | SSEQVLKFRKLNFNGEGEPEELMVDNWRPAQPLKNRQIK |
| Sec Struct: | HHHHHHHTT-BSS-TTS---B------------S---EE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| GOLGLYCEROL | R - 245 | 0 | 1 |
| GOLGLYCEROL | P - 246 | 0 | 1 |
| GOLGLYCEROL | A - 247 | 0 | 1 |
| GOLGLYCEROL | Q - 248 | 0 | 1 |
| GOLGLYCEROL | P - 249 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|