|
|
|
|
|
|
|
| Information on 1iex_A_176 |
|
Loop code: 1iex_A_176 PDB: 1iex Chain: A Type: HE alpha-beta |
Loop Start: 176 Loop Length: 22 Sec Struct Nt length: 6 Sec Struct Ct length: 5 Structure geometry
|
| Sequence: | LIPGLQGDVPKDFTSGMPFVAGKNKVAACAKHF |
| Sec Struct: | HHHHHH----TT--TT-----STTS-B-EEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| TCBTHIOCELLOBIOSE | K - 206 | 1 | 0 |
| TCBTHIOCELLOBIOSE | H - 207 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|