|
|
|
|
|
|
|
| Information on 1uuf_A_41 |
|
Loop code: 1uuf_A_41 PDB: 1uuf Chain: A Type: HE alpha-beta |
Loop Start: 41 Loop Length: 15 Sec Struct Nt length: 8 Sec Struct Ct length: 8 Structure geometry
|
| Sequence: | HSDLHQVRSEWAGTVYPCVPGHEIVGRVVAV |
| Sec Struct: | HHHHHHHH-TTS---SSB-----EEEEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| ZNZINC ION | H - 41 | 1 | 0 |
| ZNZINC ION | S - 42 | 1 | 0 |
| ZNZINC ION | D - 43 | 1 | 0 |
| ZNZINC ION | H - 62 | 0 | 1 |
| ZNZINC ION | E - 63 | 0 | 1 |
| PDB Site Annotation |
| Site | Residue | atSS | atLOOP |
| AC2 - ZN BINDING SITE FOR CHAIN A | H - 62 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|