|
|
|
|
|
|
|
| Information on 1n57_A_23 |
|
Loop code: 1n57_A_23 PDB: 1n57 Chain: A Type: HE alpha-beta |
Loop Start: 23 Loop Length: 20 Sec Struct Nt length: 7 Sec Struct Ct length: 5 Structure geometry
|
| Sequence: | EYSLSQYTSPVSDLDGVDYPKPYRGKHKILVI |
| Sec Struct: | HHHHHHH--SS--------SS---SS-EEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MSESELENOMETHIONINE | S - 25 | 1 | 0 |
| MSESELENOMETHIONINE | T - 30 | 0 | 1 |
| MSESELENOMETHIONINE | S - 31 | 0 | 1 |
| MSESELENOMETHIONINE | P - 32 | 0 | 1 |
| MSESELENOMETHIONINE | I - 51 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|