|
|
|
|
|
|
|
| Information on 1ltq_A_133 |
|
Loop code: 1ltq_A_133 PDB: 1ltq Chain: A Type: HE alpha-beta |
Loop Start: 133 Loop Length: 20 Sec Struct Nt length: 5 Sec Struct Ct length: 6 Structure geometry
|
| Sequence: | IDVLRSYKSREYLGLPVYNGTPGKPKAVIFD |
| Sec Struct: | HHHHH-----TTTT-------TTS-EEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MSESELENOMETHIONINE | D - 134 | 1 | 0 |
| MSESELENOMETHIONINE | V - 135 | 1 | 0 |
| MSESELENOMETHIONINE | L - 136 | 0 | 1 |
| MSESELENOMETHIONINE | R - 137 | 0 | 1 |
| MSESELENOMETHIONINE | S - 138 | 0 | 1 |
| MSESELENOMETHIONINE | L - 147 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|