|
|
|
|
|
|
|
| Information on 1okg_A_132 |
|
Loop code: 1okg_A_132 PDB: 1okg Chain: A Type: HE alpha-beta |
Loop Start: 132 Loop Length: 40 Sec Struct Nt length: 4 Sec Struct Ct length: 3 Structure geometry
|
| Sequence: | QACKAAGLEESGEPSSLPRPATHWPFKTAFQHHYLVDEIPPQAIITD |
| Sec Struct: | HHHHTTT----S---S---------S-SS--SB--GGGS-TT--EEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MSESELENOMETHIONINE | C - 134 | 0 | 1 |
| MSESELENOMETHIONINE | K - 135 | 0 | 1 |
| MSESELENOMETHIONINE | G - 138 | 0 | 1 |
| CACALCIUM ION | L - 139 | 0 | 1 |
| MSESELENOMETHIONINE | L - 139 | 0 | 1 |
| CACALCIUM ION | E - 140 | 0 | 1 |
| MSESELENOMETHIONINE | E - 140 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|