|
|
|
|
|
|
|
| Information on 1vrt_A_78 |
|
Loop code: 1vrt_A_78 PDB: 1vrt Chain: A Type: HE alpha-beta |
Loop Start: 78 Loop Length: 21 Sec Struct Nt length: 6 Sec Struct Ct length: 6 Structure geometry
|
| Sequence: | RELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLD |
| Sec Struct: | HHHHHHB---S--S-S---GGGS---SEEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| NEVNEVIRAPINE | P - 95 | 0 | 1 |
| NEVNEVIRAPINE | L - 100 | 0 | 1 |
| NEVNEVIRAPINE | K - 101 | 0 | 1 |
| NEVNEVIRAPINE | K - 102 | 0 | 1 |
| NEVNEVIRAPINE | K - 103 | 0 | 1 |
| NEVNEVIRAPINE | V - 106 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|