|
|
|
|
|
|
|
| Information on 1g66_A_57 |
|
Loop code: 1g66_A_57 PDB: 1g66 Chain: A Type: HE alpha-beta |
Loop Start: 57 Loop Length: 4 Sec Struct Nt length: 22 Sec Struct Ct length: 7 Structure geometry
|
| Sequence: | YSSSVAQGIAAVASAVNSFNSQCPSTKIVLVGY |
| Sec Struct: | HHHHHHHHHHHHHHHHHHHHHHSTT-EEEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| GOLGLYCEROL | Y - 57 | 1 | 0 |
| GOLGLYCEROL | S - 70 | 1 | 0 |
| GOLGLYCEROL | N - 73 | 1 | 0 |
| GOLGLYCEROL | S - 74 | 1 | 0 |
| GOLGLYCEROL | F - 75 | 1 | 0 |
| GOLGLYCEROL | S - 77 | 0 | 1 |
| GOLGLYCEROL | Q - 78 | 0 | 1 |
| Associated ArchDB40 Subclass to 1g66_A_57 |
| Associated ArchDB95 Subclass to 1g66_A_57 |
| For any comment or web-related incidence, send an email to the webmaster. |
|