|
|
|
|
|
|
|
| Information on 1o7n_B_592 |
|
Loop code: 1o7n_B_592 PDB: 1o7n Chain: B Type: HE alpha-beta |
Loop Start: 592 Loop Length: 11 Sec Struct Nt length: 12 Sec Struct Ct length: 13 Structure geometry
|
| Sequence: | FQQLKVRVEHQLDPQNWGNSPKLRFTRFITNVQAAM |
| Sec Struct: | HHHHHHHHHHHH-TT-GGGSS--EEEEEEEEEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| EDO1,2-ETHANEDIOL | R - 598 | 1 | 0 |
| EDO1,2-ETHANEDIOL | Q - 602 | 0 | 1 |
| EDO1,2-ETHANEDIOL | R - 615 | 0 | 1 |
| EDO1,2-ETHANEDIOL | F - 616 | 1 | 0 |
| PDB Site Annotation |
| Site | Residue | atSS | atLOOP |
| AC2 - EDO BINDING SITE FOR CHAIN B | Q - 602 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|