|
|
|
|
|
|
|
| Information on 1vk3_A_334 |
|
Loop code: 1vk3_A_334 PDB: 1vk3 Chain: A Type: HE alpha-beta |
Loop Start: 334 Loop Length: 23 Sec Struct Nt length: 5 Sec Struct Ct length: 2 Structure geometry
|
| Sequence: | VQLLANAPEEDIVEYTPGKIPEFKRVEFEE |
| Sec Struct: | HHHHHS------------S---------EE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MSESELENOMETHIONINE | L - 337 | 0 | 1 |
| MSESELENOMETHIONINE | A - 338 | 0 | 1 |
| MSESELENOMETHIONINE | A - 340 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|