|
|
|
|
|
|
|
| Information on 1iyb_A_14 |
|
Loop code: 1iyb_A_14 PDB: 1iyb Chain: A Type: HE alpha-beta |
Loop Start: 14 Loop Length: 19 Sec Struct Nt length: 4 Sec Struct Ct length: 8 Structure geometry
|
| Sequence: | PGSYCDTKQSCCYPKTGKPASDFGIHGLWPN |
| Sec Struct: | HHHHSSSSS-----TT-S--SS-EEEEEEEE |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| 5GPGUANOSINE-5'-MONOPHOSPHATE | Y - 17 | 0 | 1 |
| 5GPGUANOSINE-5'-MONOPHOSPHATE | H - 39 | 1 | 0 |
| 5GPGUANOSINE-5'-MONOPHOSPHATE | W - 42 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|