|
|
|
|
|
|
|
| Information on 1j4a_A_254 |
|
Loop code: 1j4a_A_254 PDB: 1j4a Chain: A Type: EH beta-alpha |
Loop Start: 254 Loop Length: 21 Sec Struct Nt length: 6 Sec Struct Ct length: 8 Structure geometry
|
| Sequence: | IFGYAMDVYEGEVGIFNEDWEGKEFPDARLADLIA |
| Sec Struct: | EEEEEES--TT-TTTTTS--TTS--S-HHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| SULSULFATE ANION | D - 260 | 0 | 1 |
| SULSULFATE ANION | V - 261 | 0 | 1 |
| SULSULFATE ANION | Y - 262 | 0 | 1 |
| SULSULFATE ANION | E - 263 | 0 | 1 |
| SULSULFATE ANION | E - 265 | 0 | 1 |
| SULSULFATE ANION | V - 266 | 0 | 1 |
| SULSULFATE ANION | F - 269 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|