|
|
|
|
|
|
|
| Information on 1nz6_A_18 |
|
Loop code: 1nz6_A_18 PDB: 1nz6 Chain: A Type: HH alpha-alpha |
Loop Start: 18 Loop Length: 22 Sec Struct Nt length: 5 Sec Struct Ct length: 14 Structure geometry
|
| Sequence: | IRALLSTHTVLWAGETKWKPVGADLVTPEQVKKVYRKAVLV |
| Sec Struct: | HHHHHT---SS-TT--S---------SHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MSESELENOMETHIONINE | R - 19 | 1 | 0 |
| MSESELENOMETHIONINE | A - 20 | 1 | 0 |
| MSESELENOMETHIONINE | L - 21 | 0 | 1 |
| MSESELENOMETHIONINE | L - 22 | 0 | 1 |
| MSESELENOMETHIONINE | S - 23 | 0 | 1 |
| MSESELENOMETHIONINE | T - 24 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|