|
|
|
|
|
|
|
| Information on 1rkt_A_84 |
|
Loop code: 1rkt_A_84 PDB: 1rkt Chain: A Type: HH alpha-alpha |
Loop Start: 84 Loop Length: 8 Sec Struct Nt length: 15 Sec Struct Ct length: 9 Structure geometry
|
| Sequence: | VWASISSYLDELTEGLRDVADTLAPVQFEYLV |
| Sec Struct: | HHHHHHHHHHHHHHHTTTGGGSSHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| UNXUNKNOWN ATOM OR ION | Y - 91 | 1 | 0 |
| UNXUNKNOWN ATOM OR ION | A - 107 | 0 | 1 |
| UNXUNKNOWN ATOM OR ION | Q - 110 | 1 | 0 |
| UNXUNKNOWN ATOM OR ION | F - 111 | 1 | 0 |
| UNXUNKNOWN ATOM OR ION | L - 114 | 1 | 0 |
| UNXUNKNOWN ATOM OR ION | V - 115 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|