|
|
|
|
|
|
|
| Information on 1s3j_A_99 |
|
Loop code: 1s3j_A_99 PDB: 1s3j Chain: A Type: HH alpha-alpha |
Loop Start: 99 Loop Length: 13 Sec Struct Nt length: 16 Sec Struct Ct length: 14 Structure geometry
|
| Sequence: | DEGDIKFEEVLAGRKAIARYLSFLTEEELQAAHITAKLAQAAE |
| Sec Struct: | HHHHHHHHHHHHHHHH--TTGGGS-S---HHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MSESELENOMETHIONINE | V - 108 | 1 | 0 |
| MSESELENOMETHIONINE | G - 111 | 1 | 0 |
| MSESELENOMETHIONINE | R - 112 | 1 | 0 |
| MSESELENOMETHIONINE | K - 113 | 0 | 1 |
| MSESELENOMETHIONINE | A - 114 | 0 | 1 |
| MSESELENOMETHIONINE | I - 115 | 0 | 1 |
| MSESELENOMETHIONINE | E - 125 | 0 | 1 |
| MSESELENOMETHIONINE | E - 126 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|