|
|
|
|
|
|
|
| Information on 1ed1_A_54 |
|
Loop code: 1ed1_A_54 PDB: 1ed1 Chain: A Type: HH alpha-alpha |
Loop Start: 54 Loop Length: 8 Sec Struct Nt length: 11 Sec Struct Ct length: 17 Structure geometry
|
| Sequence: | KEGCQKILSVLAPLVPTGSENLKSLYNTVCVIWCIH |
| Sec Struct: | HHHHHHHHHHHGGGGGG--HHHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| IPAISOPROPYL ALCOHOL | P - 66 | 0 | 1 |
| IPAISOPROPYL ALCOHOL | L - 67 | 0 | 1 |
| IPAISOPROPYL ALCOHOL | V - 68 | 0 | 1 |
| IPAISOPROPYL ALCOHOL | T - 70 | 0 | 1 |
| IPAISOPROPYL ALCOHOL | G - 71 | 0 | 1 |
| IPAISOPROPYL ALCOHOL | S - 72 | 0 | 1 |
| IPAISOPROPYL ALCOHOL | L - 75 | 1 | 0 |
| Associated ArchDB95 Subclass to 1ed1_A_54 |
| For any comment or web-related incidence, send an email to the webmaster. |
|