|
|
|
|
|
|
|
| Information on 1owl_A_149 |
|
Loop code: 1owl_A_149 PDB: 1owl Chain: A Type: HH alpha-alpha |
Loop Start: 149 Loop Length: 17 Sec Struct Nt length: 10 Sec Struct Ct length: 7 Structure geometry
|
| Sequence: | YGPFWKNWQAQPKPTPVATPTELVDLSPEQLTAI |
| Sec Struct: | HHHHHHHHHHS----------S-----HHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| PO4PHOSPHATE ION | T - 167 | 0 | 1 |
| PO4PHOSPHATE ION | T - 169 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|