|
|
|
|
|
|
|
| Information on 1lj8_A_212 |
|
Loop code: 1lj8_A_212 PDB: 1lj8 Chain: A Type: HH alpha-alpha |
Loop Start: 212 Loop Length: 14 Sec Struct Nt length: 10 Sec Struct Ct length: 11 Structure geometry
|
| Sequence: | AELHDWIKAHVSFPNAVDRITPTSTAHRLQLHDEH |
| Sec Struct: | HHHHHHHHHH-------B------HHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MSESELENOMETHIONINE | S - 223 | 0 | 1 |
| MSESELENOMETHIONINE | F - 224 | 0 | 1 |
| MSESELENOMETHIONINE | P - 225 | 0 | 1 |
| MSESELENOMETHIONINE | N - 226 | 0 | 1 |
| MSESELENOMETHIONINE | A - 227 | 0 | 1 |
| MSESELENOMETHIONINE | T - 236 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|