|
|
|
|
|
|
|
| Information on 1m66_A_300 |
|
Loop code: 1m66_A_300 PDB: 1m66 Chain: A Type: HH alpha-alpha |
Loop Start: 300 Loop Length: 4 Sec Struct Nt length: 16 Sec Struct Ct length: 11 Structure geometry
|
| Sequence: | EGVATADPLMRLAKQLKVKMPLCHQIYEIVY |
| Sec Struct: | HHHHHHHHHHHHHHHHT---HHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| PLMPALMITIC ACID | P - 320 | 0 | 1 |
| PLMPALMITIC ACID | L - 321 | 1 | 0 |
| PLMPALMITIC ACID | Q - 324 | 1 | 0 |
| PLMPALMITIC ACID | I - 325 | 1 | 0 |
| PLMPALMITIC ACID | I - 328 | 1 | 0 |
| Associated ArchDB40 Subclass to 1m66_A_300 |
| Associated ArchDB95 Subclass to 1m66_A_300 |
| For any comment or web-related incidence, send an email to the webmaster. |
|