|
|
|
|
|
|
|
| Information on 1ia6_A_174 |
|
Loop code: 1ia6_A_174 PDB: 1ia6 Chain: A Type: HH alpha-alpha |
Loop Start: 174 Loop Length: 16 Sec Struct Nt length: 20 Sec Struct Ct length: 15 Structure geometry
|
| Sequence: | SAYATKCLNAAKELYAMGKANQGVGNGQSFYQATSFGDDLAWAATWLYTAT |
| Sec Struct: | HHHHHHHHHHHHHHHHHHHHS-S----TTTS----SHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| CACALCIUM ION | A - 206 | 0 | 1 |
| CACALCIUM ION | T - 207 | 0 | 1 |
| CACALCIUM ION | S - 208 | 0 | 1 |
| CACALCIUM ION | F - 209 | 0 | 1 |
| CACALCIUM ION | G - 210 | 0 | 1 |
| CACALCIUM ION | D - 211 | 1 | 0 |
| CACALCIUM ION | D - 212 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|