Information on 1gxm_A_394 |
Loop code: 1gxm_A_394 PDB: 1gxm Chain: A Type: HH alpha-alpha |
Loop Start: 394 Loop Length: 2 Sec Struct Nt length: 14 Sec Struct Ct length: 17 Structure geometry
|
Sequence: | ITEMVFLAEVYKSGGNTKYRDAVRKAANFLVNS |
Sec Struct: | HHHHHHHHHHHHHH--HHHHHHHHHHHHHHHHH |
PDB ligands within a cut-off distance of 6 Å in this loop |
Ligands | Residue | atSS | atLOOP |
GOLGLYCEROL | T - 395 | 1 | 0 |
GOLGLYCEROL | E - 396 | 1 | 0 |
GOLGLYCEROL | V - 416 | 1 | 0 |
GOLGLYCEROL | R - 417 | 1 | 0 |
GOLGLYCEROL | K - 418 | 1 | 0 |
GOLGLYCEROL | A - 419 | 1 | 0 |
GOLGLYCEROL | A - 420 | 1 | 0 |
GOLGLYCEROL | N - 421 | 1 | 0 |
Associated ArchDB40 Subclass to 1gxm_A_394 |
Associated ArchDB95 Subclass to 1gxm_A_394 |