|
|
|
|
|
|
|
| Information on 1c3d_*_256 |
|
Loop code: 1c3d_*_256 PDB: 1c3d Chain: * Type: HH alpha-alpha |
Loop Start: 256 Loop Length: 10 Sec Struct Nt length: 10 Sec Struct Ct length: 17 Structure geometry
|
| Sequence: | VPPVVRWLNEQRYYGGGYGSTQATFMVFQALAQYQKD |
| Sec Struct: | HHHHHHHHHHTT----STT-HHHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| GOLGLYCEROL | G - 270 | 0 | 1 |
| GOLGLYCEROL | G - 271 | 0 | 1 |
| GOLGLYCEROL | G - 272 | 0 | 1 |
| GOLGLYCEROL | Y - 273 | 0 | 1 |
| GOLGLYCEROL | G - 274 | 0 | 1 |
| GOLGLYCEROL | S - 275 | 0 | 1 |
| GOLGLYCEROL | T - 276 | 0 | 1 |
| GOLGLYCEROL | T - 279 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|