|
|
|
|
|
|
|
| Information on 1iom_A_311 |
|
Loop code: 1iom_A_311 PDB: 1iom Chain: A Type: HH alpha-alpha |
Loop Start: 311 Loop Length: 7 Sec Struct Nt length: 11 Sec Struct Ct length: 23 Structure geometry
|
| Sequence: | VDFYSGVVYSDLGFSLEFFTPIFAVARISGWVGHILEYQEL |
| Sec Struct: | HHHHHHHHHHHTT--GGGHHHHHHHHHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| GOLGLYCEROL | V - 311 | 1 | 0 |
| GOLGLYCEROL | D - 312 | 1 | 0 |
| GOLGLYCEROL | S - 315 | 1 | 0 |
| CO3CARBONATE ION | F - 333 | 1 | 0 |
| GOLGLYCEROL | F - 333 | 1 | 0 |
| CO3CARBONATE ION | R - 337 | 1 | 0 |
| GOLGLYCEROL | R - 337 | 1 | 0 |
| GOLGLYCEROL | G - 343 | 1 | 0 |
| GOLGLYCEROL | L - 346 | 1 | 0 |
| GOLGLYCEROL | E - 347 | 1 | 0 |
| GOLGLYCEROL | Y - 348 | 1 | 0 |
| GOLGLYCEROL | E - 350 | 1 | 0 |
| Associated ArchDB40 Subclass to 1iom_A_311 |
| Associated ArchDB95 Subclass to 1iom_A_311 |
| For any comment or web-related incidence, send an email to the webmaster. |
|