|
|
|
|
|
|
|
| Information on 1upk_A_92 |
|
Loop code: 1upk_A_92 PDB: 1upk Chain: A Type: HH alpha-alpha |
Loop Start: 92 Loop Length: 8 Sec Struct Nt length: 15 Sec Struct Ct length: 7 Structure geometry
|
| Sequence: | FEGKKDVAQIFNNILRRQIGTRTPTVEYIC |
| Sec Struct: | HHHHHHHHHHHHHHHT--BTTB-HHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MSESELENOMETHIONINE | K - 95 | 1 | 0 |
| MSESELENOMETHIONINE | V - 98 | 1 | 0 |
| MSESELENOMETHIONINE | A - 99 | 1 | 0 |
| MSESELENOMETHIONINE | Q - 100 | 1 | 0 |
| MSESELENOMETHIONINE | I - 101 | 1 | 0 |
| MSESELENOMETHIONINE | F - 102 | 1 | 0 |
| MSESELENOMETHIONINE | N - 103 | 1 | 0 |
| MSESELENOMETHIONINE | L - 106 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|