|
|
|
|
|
|
|
| Information on 1upk_A_207 |
|
Loop code: 1upk_A_207 PDB: 1upk Chain: A Type: HH alpha-alpha |
Loop Start: 207 Loop Length: 5 Sec Struct Nt length: 11 Sec Struct Ct length: 16 Structure geometry
|
| Sequence: | YDRFFSEYEKLLHSENYVTKRQSLKLLGELLL |
| Sec Struct: | HHHHHHHHHHHTT-SSHHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MSESELENOMETHIONINE | Y - 207 | 1 | 0 |
| MSESELENOMETHIONINE | L - 218 | 0 | 1 |
| MSESELENOMETHIONINE | N - 222 | 0 | 1 |
| MSESELENOMETHIONINE | L - 230 | 1 | 0 |
| MSESELENOMETHIONINE | L - 233 | 1 | 0 |
| MSESELENOMETHIONINE | L - 236 | 1 | 0 |
| MSESELENOMETHIONINE | L - 237 | 1 | 0 |
| MSESELENOMETHIONINE | L - 238 | 1 | 0 |
| Associated ArchDB40 Subclass to 1upk_A_207 |
| Associated ArchDB95 Subclass to 1upk_A_207 |
| For any comment or web-related incidence, send an email to the webmaster. |
|