|
|
|
|
|
|
|
| Information on 1upk_A_223 |
|
Loop code: 1upk_A_223 PDB: 1upk Chain: A Type: HH alpha-alpha |
Loop Start: 223 Loop Length: 13 Sec Struct Nt length: 16 Sec Struct Ct length: 5 Structure geometry
|
| Sequence: | YVTKRQSLKLLGELLLDRHNFTITKYISKPENLK |
| Sec Struct: | HHHHHHHHHHHHHHHHSGGGTT---GGG-HHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MSESELENOMETHIONINE | L - 230 | 1 | 0 |
| MSESELENOMETHIONINE | L - 233 | 1 | 0 |
| MSESELENOMETHIONINE | L - 236 | 1 | 0 |
| MSESELENOMETHIONINE | L - 237 | 0 | 1 |
| MSESELENOMETHIONINE | L - 238 | 0 | 1 |
| MSESELENOMETHIONINE | N - 242 | 0 | 1 |
| MSESELENOMETHIONINE | F - 243 | 0 | 1 |
| MSESELENOMETHIONINE | T - 244 | 0 | 1 |
| MSESELENOMETHIONINE | I - 245 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|