|
|
|
|
|
|
|
| Information on 1upk_A_268 |
|
Loop code: 1upk_A_268 PDB: 1upk Chain: A Type: HH alpha-alpha |
Loop Start: 268 Loop Length: 5 Sec Struct Nt length: 16 Sec Struct Ct length: 9 Structure geometry
|
| Sequence: | RNIQFEAFHVFKVFVANPNKTQPILDILLK |
| Sec Struct: | HHHHHHHHHHHHHHHH-SS--HHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MSESELENOMETHIONINE | E - 273 | 1 | 0 |
| MSESELENOMETHIONINE | A - 274 | 1 | 0 |
| MSESELENOMETHIONINE | F - 275 | 1 | 0 |
| MSESELENOMETHIONINE | V - 277 | 1 | 0 |
| MSESELENOMETHIONINE | F - 278 | 1 | 0 |
| MSESELENOMETHIONINE | V - 280 | 1 | 0 |
| MSESELENOMETHIONINE | F - 281 | 1 | 0 |
| MSESELENOMETHIONINE | I - 294 | 1 | 0 |
| MSESELENOMETHIONINE | L - 295 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|