|
|
|
|
|
|
|
| Information on 1nzn_A_35 |
|
Loop code: 1nzn_A_35 PDB: 1nzn Chain: A Type: HH alpha-alpha |
Loop Start: 35 Loop Length: 5 Sec Struct Nt length: 11 Sec Struct Ct length: 14 Structure geometry
|
| Sequence: | KSTQFEYAWCLVRTRYNDDIRKGIVLLEEL |
| Sec Struct: | HHHHHHHHHHHTTSSSHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| GOLGLYCEROL | R - 49 | 0 | 1 |
| GOLGLYCEROL | Y - 50 | 0 | 1 |
| GOLGLYCEROL | N - 51 | 0 | 1 |
| GOLGLYCEROL | D - 52 | 1 | 0 |
| GOLGLYCEROL | D - 53 | 1 | 0 |
| GOLGLYCEROL | R - 55 | 1 | 0 |
| Associated ArchDB40 Subclass to 1nzn_A_35 |
| Associated ArchDB95 Subclass to 1nzn_A_35 |
| For any comment or web-related incidence, send an email to the webmaster. |
|