|
|
|
|
|
|
|
| Information on 1nzn_A_90 |
|
Loop code: 1nzn_A_90 PDB: 1nzn Chain: A Type: HH alpha-alpha |
Loop Start: 90 Loop Length: 4 Sec Struct Nt length: 14 Sec Struct Ct length: 12 Structure geometry
|
| Sequence: | YEKALKYVRGLLQTEPQNNQAKELERLIDK |
| Sec Struct: | HHHHHHHHHHHHHH-TT-HHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MSESELENOMETHIONINE | Y - 90 | 1 | 0 |
| MSESELENOMETHIONINE | E - 91 | 1 | 0 |
| MSESELENOMETHIONINE | L - 94 | 1 | 0 |
| MSESELENOMETHIONINE | L - 116 | 1 | 0 |
| MSESELENOMETHIONINE | I - 117 | 1 | 0 |
| MSESELENOMETHIONINE | D - 118 | 1 | 0 |
| MSESELENOMETHIONINE | K - 119 | 1 | 0 |
| Associated ArchDB40 Subclass to 1nzn_A_90 |
| Associated ArchDB95 Subclass to 1nzn_A_90 |
| For any comment or web-related incidence, send an email to the webmaster. |
|