|
|
|
|
|
|
|
| Information on 1q4m_A_110 |
|
Loop code: 1q4m_A_110 PDB: 1q4m Chain: A Type: HH alpha-alpha |
Loop Start: 110 Loop Length: 11 Sec Struct Nt length: 12 Sec Struct Ct length: 13 Structure geometry
|
| Sequence: | RANQEYGRFLEDLSSEVKYPVITAFWAIEAVYQESF |
| Sec Struct: | HHHHHHHHHHHH--TTS-TTT--HHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MSESELENOMETHIONINE | R - 110 | 1 | 0 |
| MSESELENOMETHIONINE | A - 111 | 1 | 0 |
| MSESELENOMETHIONINE | N - 112 | 1 | 0 |
| MSESELENOMETHIONINE | F - 118 | 1 | 0 |
| MSESELENOMETHIONINE | L - 119 | 1 | 0 |
| MSESELENOMETHIONINE | E - 120 | 0 | 1 |
| MSESELENOMETHIONINE | D - 121 | 0 | 1 |
| MSESELENOMETHIONINE | L - 122 | 0 | 1 |
| MSESELENOMETHIONINE | S - 124 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|