|
|
|
|
|
|
|
| Information on 1h3g_A_318 |
|
Loop code: 1h3g_A_318 PDB: 1h3g Chain: A Type: HH alpha-alpha |
Loop Start: 318 Loop Length: 16 Sec Struct Nt length: 10 Sec Struct Ct length: 5 Structure geometry
|
| Sequence: | GAFLTEYTRRLAEYPRLNVGEEWSTRVPVVA |
| Sec Struct: | HHHHHHHHHH----TT---B----S-HHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MSESELENOMETHIONINE | Y - 324 | 1 | 0 |
| CACALCIUM ION | T - 325 | 1 | 0 |
| MSESELENOMETHIONINE | T - 325 | 1 | 0 |
| CACALCIUM ION | R - 326 | 0 | 1 |
| MSESELENOMETHIONINE | R - 326 | 0 | 1 |
| CACALCIUM ION | R - 327 | 0 | 1 |
| MSESELENOMETHIONINE | R - 327 | 0 | 1 |
| CACALCIUM ION | L - 328 | 0 | 1 |
| MSESELENOMETHIONINE | L - 328 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|