|
|
|
|
|
|
|
| Information on 1j6o_A_220 |
|
Loop code: 1j6o_A_220 PDB: 1j6o Chain: A Type: HH alpha-alpha |
Loop Start: 220 Loop Length: 3 Sec Struct Nt length: 12 Sec Struct Ct length: 17 Structure geometry
|
| Sequence: | LKYVVETISQVLGVPEAKVDEATTENARRIFL |
| Sec Struct: | HHHHHHHHHHHHTS-HHHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| MSESELENOMETHIONINE | L - 220 | 1 | 0 |
| MSESELENOMETHIONINE | K - 221 | 1 | 0 |
| MSESELENOMETHIONINE | Y - 222 | 1 | 0 |
| MSESELENOMETHIONINE | V - 223 | 1 | 0 |
| MSESELENOMETHIONINE | V - 224 | 1 | 0 |
| MSESELENOMETHIONINE | D - 239 | 1 | 0 |
| MSESELENOMETHIONINE | T - 242 | 1 | 0 |
| MSESELENOMETHIONINE | T - 243 | 1 | 0 |
| Associated ArchDB40 Subclass to 1j6o_A_220 |
| Associated ArchDB95 Subclass to 1j6o_A_220 |
| For any comment or web-related incidence, send an email to the webmaster. |
|