|
|
|
|
|
|
|
| Information on 1rhc_A_109 |
|
Loop code: 1rhc_A_109 PDB: 1rhc Chain: A Type: HH alpha-alpha |
Loop Start: 109 Loop Length: 5 Sec Struct Nt length: 8 Sec Struct Ct length: 20 Structure geometry
|
| Sequence: | AMNEVPVTGEWPSVPVRQDMTVEAVKVMRMLWE |
| Sec Struct: | HHHHHHHH-----HHHHHHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| ACNACETONE | N - 111 | 1 | 0 |
| F42COENZYME F420 | N - 111 | 1 | 0 |
| F42COENZYME F420 | E - 112 | 1 | 0 |
| F42COENZYME F420 | V - 122 | 0 | 1 |
| F42COENZYME F420 | R - 125 | 1 | 0 |
| F42COENZYME F420 | Q - 126 | 1 | 0 |
| Associated ArchDB40 Subclass to 1rhc_A_109 |
| Associated ArchDB95 Subclass to 1rhc_A_109 |
| For any comment or web-related incidence, send an email to the webmaster. |
|