|
|
|
|
|
|
|
| Information on 1bg2_*_91 |
|
Loop code: 1bg2_*_91 PDB: 1bg2 Chain: * Type: HH alpha-alpha |
Loop Start: 91 Loop Length: 11 Sec Struct Nt length: 5 Sec Struct Ct length: 16 Structure geometry
|
| Sequence: | KTHTMEGKLHDPEGMGIIPRIVQDIFNYIYSM |
| Sec Struct: | HHHHHTBSTT-TTTB-HHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| ADPADENOSINE-5'-DIPHOSPHATE | K - 91 | 1 | 0 |
| MGMAGNESIUM ION | K - 91 | 1 | 0 |
| ADPADENOSINE-5'-DIPHOSPHATE | T - 92 | 1 | 0 |
| MGMAGNESIUM ION | T - 92 | 1 | 0 |
| ADPADENOSINE-5'-DIPHOSPHATE | H - 93 | 1 | 0 |
| ADPADENOSINE-5'-DIPHOSPHATE | T - 94 | 0 | 1 |
| ACTACETATE ION | M - 95 | 0 | 1 |
| ACTACETATE ION | E - 96 | 0 | 1 |
| ACTACETATE ION | I - 108 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|