|
|
|
|
|
|
|
| Information on 1r4w_A_44 |
|
Loop code: 1r4w_A_44 PDB: 1r4w Chain: A Type: HH alpha-alpha |
Loop Start: 44 Loop Length: 9 Sec Struct Nt length: 7 Sec Struct Ct length: 18 Structure geometry
|
| Sequence: | LAGIMKDSGNQPPAMVPHKGQYILKEIPLLKQLF |
| Sec Struct: | HHHHHHHTT---TTSSHHHHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| GSHGLUTHATHIONE | L - 44 | 1 | 0 |
| GSHGLUTHATHIONE | M - 48 | 1 | 0 |
| GSHGLUTHATHIONE | N - 53 | 0 | 1 |
| GSHGLUTHATHIONE | Q - 54 | 0 | 1 |
| GSHGLUTHATHIONE | P - 56 | 0 | 1 |
| GSHGLUTHATHIONE | V - 59 | 0 | 1 |
| GSHGLUTHATHIONE | K - 62 | 1 | 0 |
| GSHGLUTHATHIONE | I - 66 | 1 | 0 |
| GSHGLUTHATHIONE | E - 69 | 1 | 0 |
| GSHGLUTHATHIONE | L - 73 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|