|
|
|
|
|
|
|
| Information on 1kfs_A_473 |
|
Loop code: 1kfs_A_473 PDB: 1kfs Chain: A Type: HH alpha-alpha |
Loop Start: 473 Loop Length: 13 Sec Struct Nt length: 5 Sec Struct Ct length: 25 Structure geometry
|
| Sequence: | FEEIAGKGKNQLTFNQIALEEAGRYAAEDADVTLQLHLKMWPD |
| Sec Struct: | HHHHH-SGGG---GGGS-HHHHHHHHHHHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| ZNZINC ION | Y - 497 | 1 | 0 |
| ZNZINC ION | A - 498 | 1 | 0 |
| MGMAGNESIUM ION | D - 501 | 1 | 0 |
| ZNZINC ION | D - 501 | 1 | 0 |
| ZNZINC ION | A - 502 | 1 | 0 |
| PDB Site Annotation |
| Site | Residue | atSS | atLOOP |
| EXO - EXONUCLEASE ACTIVE SITE. | D - 501 | 1 | 0 |
| For any comment or web-related incidence, send an email to the webmaster. |
|