|
|
|
|
|
|
|
| Information on 1odk_A_114 |
|
Loop code: 1odk_A_114 PDB: 1odk Chain: A Type: HH alpha-alpha |
Loop Start: 114 Loop Length: 10 Sec Struct Nt length: 7 Sec Struct Ct length: 13 Structure geometry
|
| Sequence: | GTTRQYLEGRPYAPVPDPEVFRALWRRAEA |
| Sec Struct: | HHHHHHHTT--------HHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| GOLGLYCEROL | Y - 119 | 0 | 1 |
| GOLGLYCEROL | L - 120 | 0 | 1 |
| GOLGLYCEROL | E - 121 | 0 | 1 |
| GOLGLYCEROL | R - 123 | 0 | 1 |
| PDB Site Annotation |
| Site | Residue | atSS | atLOOP |
| AC6 - GOL BINDING SITE FOR CHAIN A | R - 123 | 0 | 1 |
| For any comment or web-related incidence, send an email to the webmaster. |
|