|
|
|
|
|
|
|
| Information on 1qpg_*_56 |
|
Loop code: 1qpg_*_56 PDB: 1qpg Chain: * Type: EH beta-alpha |
Loop Start: 56 Loop Length: 16 Sec Struct Nt length: 5 Sec Struct Ct length: 11 Structure geometry
|
| Sequence: | YVVLASHLGQPNGERNEKYSLAPVAKELQSLL |
| Sec Struct: | EEEEE---S---SS--GGG-SHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| 3PG3-PHOSPHOGLYCERIC ACID | S - 61 | 0 | 1 |
| 3PG3-PHOSPHOGLYCERIC ACID | H - 62 | 0 | 1 |
| 3PG3-PHOSPHOGLYCERIC ACID | G - 64 | 0 | 1 |
| Associated ArchDB-KI Subclass to 1qpg_*_56 |
| For any comment or web-related incidence, send an email to the webmaster. |
|