|
|
|
|
|
|
|
| Information on 1dpe_*_437 |
|
Loop code: 1dpe_*_437 PDB: 1dpe Chain: * Type: HH alpha-alpha |
Loop Start: 437 Loop Length: 3 Sec Struct Nt length: 12 Sec Struct Ct length: 18 Structure geometry
|
| Sequence: | KPFEDLIQPARATDDHNKRVELYKQAQVVMHDQ |
| Sec Struct: | HHHHHHHHHHHH---HHHHHHHHHHHHHHHHHH |
| PDB ligands within a cut-off distance of 6 Å in this loop |
| Ligands | Residue | atSS | atLOOP |
| CDCADMIUM ION | H - 452 | 0 | 1 |
| CDCADMIUM ION | V - 456 | 1 | 0 |
| CDCADMIUM ION | E - 457 | 1 | 0 |
| CDCADMIUM ION | H - 467 | 1 | 0 |
| CDCADMIUM ION | D - 468 | 1 | 0 |
| Associated ArchDB40 Subclass to 1dpe_*_437 |
| Associated ArchDB95 Subclass to 1dpe_*_437 |
| For any comment or web-related incidence, send an email to the webmaster. |
|